General Information

  • ID:  hor004575
  • Uniprot ID:  P62329
  • Protein name:  Hematopoietic system regulatory peptide
  • Gene name:  Tmsb4x
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Thymosin beta family
  • Source:  Animal
  • Expression:  By NGF and fibroblast growth factors. |Originally found in thymus but it is widely distributed in many tissues.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding; GO:0019899 enzyme binding; GO:0140311 protein sequestering activity
  • GO BP:  GO:0001649 osteoblast differentiation; GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0033209 tumor necrosis factor-mediated signaling pathway; GO:0042989 sequestering of actin monomers; GO:0043124 negative regulation of canonical NF-kappaB signal transduction; GO:0043536 positive regulation of blood vessel endothelial cell migration; GO:0050728 negative regulation of inflammatory response; GO:2001028 positive regulation of endothelial cell chemotaxis; GO:2001171 positive regulation of ATP biosynthetic process
  • GO CC:  GO:0005634 nucleus; GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  SDKP
  • Length:  4(2-5)
  • Propeptide:  MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine;T1 Phosphoserine;T3 N6-acetyllysine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibits the entry of hematopoietic pluripotent stem cells into the S-phase
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  Actb
  • Target Unid:  P60711
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 80 minutes; /4800 seconds ( PubMed ID: 8257427 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P62329-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004575_AF2.pdbhor004575_ESM.pdb

Physical Information

Mass: 49916 Formula: C18H31N5O8
Absent amino acids: ACEFGHILMNQRTVWY Common amino acids: DKPS
pI: 6.34 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 0
Hydrophobicity: -245 Boman Index: -1767
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: -3257.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8257427
  • Title:  NA